Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Overall Prediction Electron Density

Summary

Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 13,909
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 13,900
  3. Avatar for Russian team 13. Russian team 1 pt. 13,869
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 13,741
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 12,339
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 9,792
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 8,728
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 46 pts. 14,163
  2. Avatar for hansvandenhof 22. hansvandenhof Lv 1 45 pts. 14,140
  3. Avatar for Glen B 23. Glen B Lv 1 43 pts. 14,134
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 41 pts. 14,115
  5. Avatar for Bautho 25. Bautho Lv 1 39 pts. 14,103
  6. Avatar for Mike Cassidy 26. Mike Cassidy Lv 1 38 pts. 14,098
  7. Avatar for Alistair69 27. Alistair69 Lv 1 36 pts. 14,096
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 34 pts. 14,079
  9. Avatar for bertro 29. bertro Lv 1 33 pts. 14,079
  10. Avatar for Vinara 30. Vinara Lv 1 32 pts. 14,064

Comments

beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG