Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Overall Prediction Electron Density

Summary


Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 13,909
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 13,900
  3. Avatar for Russian team 13. Russian team 1 pt. 13,869
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 13,741
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 12,339
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 9,792
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 8,728
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0

  1. Avatar for alwen 51. alwen Lv 1 11 pts. 13,828
  2. Avatar for johngran 52. johngran Lv 1 11 pts. 13,826
  3. Avatar for gozulio 53. gozulio Lv 1 10 pts. 13,819
  4. Avatar for guineapig 54. guineapig Lv 1 10 pts. 13,809
  5. Avatar for rabamino12358 55. rabamino12358 Lv 1 9 pts. 13,773
  6. Avatar for knotartist 56. knotartist Lv 1 9 pts. 13,765
  7. Avatar for Dhalion 57. Dhalion Lv 1 8 pts. 13,760
  8. Avatar for Steven Pletsch 58. Steven Pletsch Lv 1 8 pts. 13,741
  9. Avatar for jobo0502 59. jobo0502 Lv 1 7 pts. 13,716
  10. Avatar for Museka 60. Museka Lv 1 7 pts. 13,713

Comments


beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG