Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Overall Prediction Electron Density

Summary

Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 13,909
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 13,900
  3. Avatar for Russian team 13. Russian team 1 pt. 13,869
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 13,741
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 12,339
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 9,792
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 8,728
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for ManVsYard 71. ManVsYard Lv 1 4 pts. 13,539
  2. Avatar for Jorge Cantero 72. Jorge Cantero Lv 1 3 pts. 13,512
  3. Avatar for WBarme1234 73. WBarme1234 Lv 1 3 pts. 13,495
  4. Avatar for hada 74. hada Lv 1 3 pts. 13,482
  5. Avatar for johnmitch 75. johnmitch Lv 1 3 pts. 13,404
  6. Avatar for phi16 76. phi16 Lv 1 3 pts. 13,359
  7. Avatar for jameslemmate 77. jameslemmate Lv 1 2 pts. 13,354
  8. Avatar for PeterDav 78. PeterDav Lv 1 2 pts. 13,326
  9. Avatar for cinnamonkitty 79. cinnamonkitty Lv 1 2 pts. 13,295
  10. Avatar for JasperD 80. JasperD Lv 1 2 pts. 13,276

Comments

beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG