Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,429
  2. Avatar for Go Science 2. Go Science 74 pts. 10,408
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,337
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 10,300
  5. Avatar for Contenders 5. Contenders 27 pts. 10,295
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,294
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,283
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,123
  9. Avatar for Russian team 9. Russian team 5 pts. 10,070
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,990
  1. Avatar for justjustin 101. justjustin Lv 1 1 pt. 7,842
  2. Avatar for VKVODK 102. VKVODK Lv 1 1 pt. 7,828
  3. Avatar for Pavel1940 103. Pavel1940 Lv 1 1 pt. 7,811
  4. Avatar for Louis K 104. Louis K Lv 1 1 pt. 7,808
  5. Avatar for YorkG 105. YorkG Lv 1 1 pt. 7,663
  6. Avatar for marcramossala 106. marcramossala Lv 1 1 pt. 7,658
  7. Avatar for Xenom Apperance 107. Xenom Apperance Lv 1 1 pt. 7,535
  8. Avatar for holyblakeqc 108. holyblakeqc Lv 1 1 pt. 7,520
  9. Avatar for smais 109. smais Lv 1 1 pt. 7,497
  10. Avatar for PascalProvencher 110. PascalProvencher Lv 1 1 pt. 7,491

Comments