Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,429
  2. Avatar for Go Science 2. Go Science 74 pts. 10,408
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,337
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 10,300
  5. Avatar for Contenders 5. Contenders 27 pts. 10,295
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,294
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,283
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,123
  9. Avatar for Russian team 9. Russian team 5 pts. 10,070
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,990

  1. Avatar for thewholeblahthing 61. thewholeblahthing Lv 1 5 pts. 8,996
  2. Avatar for kevin everington 62. kevin everington Lv 1 5 pts. 8,915
  3. Avatar for tjrana 63. tjrana Lv 1 5 pts. 8,897
  4. Avatar for kubek915 64. kubek915 Lv 1 5 pts. 8,862
  5. Avatar for aznarog 65. aznarog Lv 1 4 pts. 8,858
  6. Avatar for rezaefar 66. rezaefar Lv 1 4 pts. 8,818
  7. Avatar for tela 67. tela Lv 1 4 pts. 8,815
  8. Avatar for KotaWharton 68. KotaWharton Lv 1 4 pts. 8,812
  9. Avatar for ciberhunter 69. ciberhunter Lv 1 3 pts. 8,751
  10. Avatar for Arne Heessels 70. Arne Heessels Lv 1 3 pts. 8,749

Comments