Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,429
  2. Avatar for Go Science 2. Go Science 74 pts. 10,408
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,337
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 10,300
  5. Avatar for Contenders 5. Contenders 27 pts. 10,295
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 10,294
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,283
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,123
  9. Avatar for Russian team 9. Russian team 5 pts. 10,070
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,990
  1. Avatar for kitek314_pl 41. kitek314_pl Lv 1 17 pts. 9,596
  2. Avatar for knotartist 42. knotartist Lv 1 16 pts. 9,567
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 15 pts. 9,533
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 15 pts. 9,511
  5. Avatar for Vinara 45. Vinara Lv 1 14 pts. 9,480
  6. Avatar for Hellcat6 46. Hellcat6 Lv 1 13 pts. 9,474
  7. Avatar for hansvandenhof 47. hansvandenhof Lv 1 12 pts. 9,465
  8. Avatar for alcor29 48. alcor29 Lv 1 12 pts. 9,402
  9. Avatar for georg137 49. georg137 Lv 1 11 pts. 9,377
  10. Avatar for fpc 50. fpc Lv 1 11 pts. 9,275

Comments