frood66 Lv 1
were these puzzles set in the wrong order?
1770: Electron Density Kinesin Coiled-Coil: Round 2
Closed since over 6 years ago
Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron DensitySummary
- Created
- December 09, 2019
- Expires
- Max points
- 100
Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.
This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!
Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG