Placeholder image of a protein
Icon representing a puzzle

1770: Electron Density Kinesin Coiled-Coil: Round 2

Closed since over 6 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
December 09, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.



This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,279
  2. Avatar for Go Science 2. Go Science 71 pts. 14,271
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 14,260
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 14,240
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 14,229
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 14,227
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 14,225
  8. Avatar for Russian team 8. Russian team 5 pts. 14,210
  9. Avatar for Contenders 9. Contenders 3 pts. 14,206
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 14,179

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 14,276
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 96 pts. 14,270
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 91 pts. 14,261
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 87 pts. 14,253
  5. Avatar for Phyx 5. Phyx Lv 1 82 pts. 14,252
  6. Avatar for LociOiling 6. LociOiling Lv 1 78 pts. 14,250
  7. Avatar for jeff101 7. jeff101 Lv 1 74 pts. 14,237
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 70 pts. 14,235
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 67 pts. 14,231
  10. Avatar for grogar7 10. grogar7 Lv 1 63 pts. 14,230

Comments