Placeholder image of a protein
Icon representing a puzzle

1770: Electron Density Kinesin Coiled-Coil: Round 2

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 09, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.



This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 14,141
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,992
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 13,940
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 13,908
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 13,741
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 13,341

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 14,276
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 96 pts. 14,270
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 91 pts. 14,261
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 87 pts. 14,253
  5. Avatar for Phyx 5. Phyx Lv 1 82 pts. 14,252
  6. Avatar for LociOiling 6. LociOiling Lv 1 78 pts. 14,250
  7. Avatar for jeff101 7. jeff101 Lv 1 74 pts. 14,237
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 70 pts. 14,235
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 67 pts. 14,231
  10. Avatar for grogar7 10. grogar7 Lv 1 63 pts. 14,230

Comments