Placeholder image of a protein
Icon representing a puzzle

1770: Electron Density Kinesin Coiled-Coil: Round 2

Closed since over 6 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
December 09, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.



This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 14,141
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,992
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 13,940
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 13,908
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 13,741
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 13,341

  1. Avatar for Pawel Tluscik 61. Pawel Tluscik Lv 1 2 pts. 13,967
  2. Avatar for Vinara 62. Vinara Lv 1 1 pt. 13,947
  3. Avatar for ghiggins 63. ghiggins Lv 1 1 pt. 13,940
  4. Avatar for kevin everington 64. kevin everington Lv 1 1 pt. 13,930
  5. Avatar for detectorist 65. detectorist Lv 1 1 pt. 13,928
  6. Avatar for rabamino12358 66. rabamino12358 Lv 1 1 pt. 13,928
  7. Avatar for Psych0Active 67. Psych0Active Lv 1 1 pt. 13,920
  8. Avatar for tjrana 68. tjrana Lv 1 1 pt. 13,918
  9. Avatar for rinze 69. rinze Lv 1 1 pt. 13,917
  10. Avatar for haabermaaster 70. haabermaaster Lv 1 1 pt. 13,908

Comments