Placeholder image of a protein
Icon representing a puzzle

1770: Electron Density Kinesin Coiled-Coil: Round 2

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 09, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.



This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,279
  2. Avatar for Go Science 2. Go Science 71 pts. 14,271
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 14,260
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 14,240
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 14,229
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 14,227
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 14,225
  8. Avatar for Russian team 8. Russian team 5 pts. 14,210
  9. Avatar for Contenders 9. Contenders 3 pts. 14,206
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 14,179

  1. Avatar for jobo0502 81. jobo0502 Lv 1 1 pt. 13,690
  2. Avatar for schniouf 82. schniouf Lv 1 1 pt. 13,677
  3. Avatar for Hellcat6 83. Hellcat6 Lv 1 1 pt. 13,660
  4. Avatar for jameslemmate 84. jameslemmate Lv 1 1 pt. 13,603
  5. Avatar for Sciren 85. Sciren Lv 1 1 pt. 13,596
  6. Avatar for multaq 86. multaq Lv 1 1 pt. 13,555
  7. Avatar for Charlebon 87. Charlebon Lv 1 1 pt. 13,534
  8. Avatar for WBarme1234 88. WBarme1234 Lv 1 1 pt. 13,495
  9. Avatar for Bithalbierer 89. Bithalbierer Lv 1 1 pt. 13,341
  10. Avatar for robloxfan216 90. robloxfan216 Lv 1 1 pt. 11,597

Comments