Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for navn 91. navn Lv 1 1 pt. 7,739
  2. Avatar for Belle36 92. Belle36 Lv 1 1 pt. 7,573
  3. Avatar for Altercomp 93. Altercomp Lv 1 1 pt. 7,487
  4. Avatar for micheldeweerd 94. micheldeweerd Lv 1 1 pt. 7,442
  5. Avatar for acetyl-CoA carboxylase 95. acetyl-CoA carboxylase Lv 1 1 pt. 7,430
  6. Avatar for alyssa_d_V2.0 96. alyssa_d_V2.0 Lv 1 1 pt. 7,405
  7. Avatar for Charlebon 97. Charlebon Lv 1 1 pt. 7,405
  8. Avatar for pascal ochem 98. pascal ochem Lv 1 1 pt. 7,303
  9. Avatar for ausername123 99. ausername123 Lv 1 1 pt. 7,252
  10. Avatar for hajtogato 100. hajtogato Lv 1 1 pt. 7,227

Comments