Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for Kevin76 101. Kevin76 Lv 1 1 pt. 7,187
  2. Avatar for pgibsonc 102. pgibsonc Lv 1 1 pt. 7,187
  3. Avatar for quantrarily04 103. quantrarily04 Lv 1 1 pt. 7,114
  4. Avatar for sielenk 104. sielenk Lv 1 1 pt. 7,036
  5. Avatar for YorkG 105. YorkG Lv 1 1 pt. 6,942
  6. Avatar for Museka 106. Museka Lv 1 1 pt. 6,819
  7. Avatar for AlecM 107. AlecM Lv 1 1 pt. 6,808
  8. Avatar for emtonsti 108. emtonsti Lv 1 1 pt. 6,783
  9. Avatar for Arwagollon 109. Arwagollon Lv 1 1 pt. 6,616
  10. Avatar for Psych0Active 110. Psych0Active Lv 1 1 pt. 6,533

Comments