Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for Aubade01 11. Aubade01 Lv 1 65 pts. 10,249
  2. Avatar for crpainter 12. crpainter Lv 1 62 pts. 10,226
  3. Avatar for Deleted player 13. Deleted player pts. 10,223
  4. Avatar for johnmitch 14. johnmitch Lv 1 57 pts. 10,214
  5. Avatar for Galaxie 15. Galaxie Lv 1 54 pts. 10,199
  6. Avatar for robgee 16. robgee Lv 1 52 pts. 10,189
  7. Avatar for Enzyme 17. Enzyme Lv 1 49 pts. 10,184
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 47 pts. 10,178
  9. Avatar for frood66 19. frood66 Lv 1 45 pts. 10,173
  10. Avatar for vakobo 20. vakobo Lv 1 43 pts. 10,163

Comments