Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for jobo0502 21. jobo0502 Lv 1 41 pts. 10,148
  2. Avatar for Blipperman 22. Blipperman Lv 1 39 pts. 10,145
  3. Avatar for phi16 23. phi16 Lv 1 37 pts. 10,131
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 35 pts. 10,098
  5. Avatar for aznarog 25. aznarog Lv 1 33 pts. 10,096
  6. Avatar for vuvuvu 26. vuvuvu Lv 1 32 pts. 10,095
  7. Avatar for Marvelz 27. Marvelz Lv 1 30 pts. 10,085
  8. Avatar for jausmh 28. jausmh Lv 1 28 pts. 10,070
  9. Avatar for Norrjane 29. Norrjane Lv 1 27 pts. 10,067
  10. Avatar for nicobul 30. nicobul Lv 1 26 pts. 10,033

Comments