Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for Idiotboy 51. Idiotboy Lv 1 7 pts. 9,482
  2. Avatar for knotartist 52. knotartist Lv 1 7 pts. 9,359
  3. Avatar for RockOn 53. RockOn Lv 1 6 pts. 9,273
  4. Avatar for rezaefar 54. rezaefar Lv 1 6 pts. 9,268
  5. Avatar for Glen B 55. Glen B Lv 1 6 pts. 9,241
  6. Avatar for Silvercraft 56. Silvercraft Lv 1 5 pts. 9,108
  7. Avatar for georg137 57. georg137 Lv 1 5 pts. 9,105
  8. Avatar for CAN1958 58. CAN1958 Lv 1 4 pts. 9,051
  9. Avatar for kitek314_pl 59. kitek314_pl Lv 1 4 pts. 9,024
  10. Avatar for tarimo 60. tarimo Lv 1 4 pts. 8,978

Comments