Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,408
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,388
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,325
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,309
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,291
  6. Avatar for Contenders 6. Contenders 14 pts. 10,226
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,196
  8. Avatar for Russian team 8. Russian team 5 pts. 10,163
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,148
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 10,095
  1. Avatar for 01010011111 111. 01010011111 Lv 1 1 pt. 6,532
  2. Avatar for SayMyName 112. SayMyName Lv 1 1 pt. 6,532
  3. Avatar for simsun 113. simsun Lv 1 1 pt. 6,478
  4. Avatar for Martyg 114. Martyg Lv 1 1 pt. 5,020
  5. Avatar for BioFurther 115. BioFurther Lv 1 1 pt. 1,962
  6. Avatar for JellyJump 116. JellyJump Lv 1 1 pt. 0
  7. Avatar for htvwhite 117. htvwhite Lv 1 1 pt. 0
  8. Avatar for esiaste 118. esiaste Lv 1 1 pt. 0
  9. Avatar for toshiue 119. toshiue Lv 1 1 pt. 0
  10. Avatar for ManVsYard 120. ManVsYard Lv 1 1 pt. 0

Comments