Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Go Science 100 pts. 10,408
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,388
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,325
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,309
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,291
  6. Avatar for Contenders 6. Contenders 14 pts. 10,226
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,196
  8. Avatar for Russian team 8. Russian team 5 pts. 10,163
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,148
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 10,095

  1. Avatar for Old Chap 81. Old Chap Lv 1 1 pt. 8,158
  2. Avatar for Datstandin 82. Datstandin Lv 1 1 pt. 8,150
  3. Avatar for cbwest 83. cbwest Lv 1 1 pt. 8,094
  4. Avatar for claatou 84. claatou Lv 1 1 pt. 8,090
  5. Avatar for Simek 85. Simek Lv 1 1 pt. 8,078
  6. Avatar for cobaltteal 86. cobaltteal Lv 1 1 pt. 8,005
  7. Avatar for Louchat78 87. Louchat78 Lv 1 1 pt. 7,888
  8. Avatar for kevin everington 88. kevin everington Lv 1 1 pt. 7,885
  9. Avatar for boondog 89. boondog Lv 1 1 pt. 7,793
  10. Avatar for abiogenesis 90. abiogenesis Lv 1 1 pt. 7,767

Comments