Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,833
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,793
  3. Avatar for Contenders 3. Contenders 52 pts. 9,785
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,779
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,740
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,738
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,708
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,658
  9. Avatar for Russian team 9. Russian team 4 pts. 9,567
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,564
  1. Avatar for navn 71. navn Lv 1 2 pts. 8,378
  2. Avatar for JasperD 72. JasperD Lv 1 1 pt. 8,375
  3. Avatar for ManVsYard 73. ManVsYard Lv 1 1 pt. 8,342
  4. Avatar for alyssa_d_V2.0 74. alyssa_d_V2.0 Lv 1 1 pt. 8,321
  5. Avatar for Naing25 75. Naing25 Lv 1 1 pt. 8,280
  6. Avatar for ppp6 76. ppp6 Lv 1 1 pt. 8,175
  7. Avatar for vuvuvu 77. vuvuvu Lv 1 1 pt. 8,173
  8. Avatar for Savas 78. Savas Lv 1 1 pt. 8,148
  9. Avatar for kitek314_pl 79. kitek314_pl Lv 1 1 pt. 8,143
  10. Avatar for roman madala 80. roman madala Lv 1 1 pt. 8,121

Comments