Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,833
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,793
  3. Avatar for Contenders 3. Contenders 52 pts. 9,785
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,779
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,740
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,738
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,708
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,658
  9. Avatar for Russian team 9. Russian team 4 pts. 9,567
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,564
  1. Avatar for claatou 81. claatou Lv 1 1 pt. 8,098
  2. Avatar for rabamino12358 82. rabamino12358 Lv 1 1 pt. 8,093
  3. Avatar for Marvelz 83. Marvelz Lv 1 1 pt. 8,033
  4. Avatar for Squirrely 84. Squirrely Lv 1 1 pt. 8,012
  5. Avatar for cobaltteal 85. cobaltteal Lv 1 1 pt. 7,995
  6. Avatar for koffikolo 86. koffikolo Lv 1 1 pt. 7,865
  7. Avatar for Tinkledeath 87. Tinkledeath Lv 1 1 pt. 7,859
  8. Avatar for multaq 88. multaq Lv 1 1 pt. 7,835
  9. Avatar for mrfu 89. mrfu Lv 1 1 pt. 7,795
  10. Avatar for harvardman 90. harvardman Lv 1 1 pt. 7,776

Comments