Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for Crazy Chemist 101. Crazy Chemist Lv 1 1 pt. 7,336
  2. Avatar for gdnskye 102. gdnskye Lv 1 1 pt. 7,310
  3. Avatar for 01010011111 103. 01010011111 Lv 1 1 pt. 7,149
  4. Avatar for halblauterpc 104. halblauterpc Lv 1 1 pt. 6,658
  5. Avatar for xrup 105. xrup Lv 1 1 pt. 5,075
  6. Avatar for katling 106. katling Lv 1 1 pt. 4,986
  7. Avatar for fold_in_fold 107. fold_in_fold Lv 1 1 pt. 4,760
  8. Avatar for multaq 108. multaq Lv 1 1 pt. 4,300
  9. Avatar for lconor 109. lconor Lv 1 1 pt. 4,300

Comments