Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for RockOn 11. RockOn Lv 1 62 pts. 9,746
  2. Avatar for nicobul 12. nicobul Lv 1 59 pts. 9,734
  3. Avatar for johnmitch 13. johnmitch Lv 1 56 pts. 9,700
  4. Avatar for grogar7 14. grogar7 Lv 1 53 pts. 9,685
  5. Avatar for Blipperman 15. Blipperman Lv 1 50 pts. 9,684
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 48 pts. 9,663
  7. Avatar for robgee 17. robgee Lv 1 45 pts. 9,656
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 43 pts. 9,654
  9. Avatar for MicElephant 19. MicElephant Lv 1 41 pts. 9,632
  10. Avatar for phi16 20. phi16 Lv 1 39 pts. 9,618

Comments