Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for aznarog 21. aznarog Lv 1 36 pts. 9,590
  2. Avatar for Enzyme 22. Enzyme Lv 1 34 pts. 9,581
  3. Avatar for frood66 23. frood66 Lv 1 33 pts. 9,575
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 31 pts. 9,566
  5. Avatar for jobo0502 25. jobo0502 Lv 1 29 pts. 9,541
  6. Avatar for silent gene 26. silent gene Lv 1 27 pts. 9,518
  7. Avatar for haabermaaster 27. haabermaaster Lv 1 26 pts. 9,509
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 24 pts. 9,487
  9. Avatar for diamonddays 29. diamonddays Lv 1 23 pts. 9,485
  10. Avatar for Deleted player 30. Deleted player pts. 9,477

Comments