Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for abiogenesis 61. abiogenesis Lv 1 2 pts. 8,997
  2. Avatar for Arne Heessels 62. Arne Heessels Lv 1 2 pts. 8,994
  3. Avatar for Vincera 63. Vincera Lv 1 2 pts. 8,984
  4. Avatar for heather-1 64. heather-1 Lv 1 2 pts. 8,980
  5. Avatar for rezaefar 65. rezaefar Lv 1 2 pts. 8,963
  6. Avatar for manu8170 66. manu8170 Lv 1 2 pts. 8,939
  7. Avatar for roman madala 67. roman madala Lv 1 1 pt. 8,928
  8. Avatar for ChargingFerret 68. ChargingFerret Lv 1 1 pt. 8,913
  9. Avatar for knotartist 69. knotartist Lv 1 1 pt. 8,877
  10. Avatar for kevin everington 70. kevin everington Lv 1 1 pt. 8,868

Comments