Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for Squirrely 81. Squirrely Lv 1 1 pt. 8,697
  2. Avatar for navn 82. navn Lv 1 1 pt. 8,670
  3. Avatar for Simek 83. Simek Lv 1 1 pt. 8,661
  4. Avatar for hexidecimalhack 84. hexidecimalhack Lv 1 1 pt. 8,552
  5. Avatar for MrZanav 85. MrZanav Lv 1 1 pt. 8,542
  6. Avatar for harvardman 86. harvardman Lv 1 1 pt. 8,500
  7. Avatar for ghiggins 87. ghiggins Lv 1 1 pt. 8,467
  8. Avatar for Bithalbierer 88. Bithalbierer Lv 1 1 pt. 8,434
  9. Avatar for micheldeweerd 89. micheldeweerd Lv 1 1 pt. 8,374
  10. Avatar for hajtogato 90. hajtogato Lv 1 1 pt. 8,259

Comments