Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393

  1. Avatar for Amynet 91. Amynet Lv 1 1 pt. 8,250
  2. Avatar for Savas 92. Savas Lv 1 1 pt. 8,229
  3. Avatar for PeterDav 93. PeterDav Lv 1 1 pt. 8,170
  4. Avatar for NewZealand 94. NewZealand Lv 1 1 pt. 7,998
  5. Avatar for ManVsYard 95. ManVsYard Lv 1 1 pt. 7,942
  6. Avatar for justjustin 96. justjustin Lv 1 1 pt. 7,897
  7. Avatar for momadoc 97. momadoc Lv 1 1 pt. 7,846
  8. Avatar for LostRosa 98. LostRosa Lv 1 1 pt. 7,757
  9. Avatar for nagasan64 99. nagasan64 Lv 1 1 pt. 7,718
  10. Avatar for Jiaying Huang 100. Jiaying Huang Lv 1 1 pt. 7,401

Comments