Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393
  1. Avatar for marcramossala 71. marcramossala Lv 1 1 pt. 8,856
  2. Avatar for cobaltteal 72. cobaltteal Lv 1 1 pt. 8,838
  3. Avatar for ppp6 73. ppp6 Lv 1 1 pt. 8,835
  4. Avatar for Pisqis 74. Pisqis Lv 1 1 pt. 8,810
  5. Avatar for alyssa_d_V2.0 75. alyssa_d_V2.0 Lv 1 1 pt. 8,804
  6. Avatar for pfirth 76. pfirth Lv 1 1 pt. 8,804
  7. Avatar for rinze 77. rinze Lv 1 1 pt. 8,802
  8. Avatar for hada 78. hada Lv 1 1 pt. 8,790
  9. Avatar for gurch 79. gurch Lv 1 1 pt. 8,722
  10. Avatar for CharlieFortsConscience 80. CharlieFortsConscience Lv 1 1 pt. 8,720

Comments