Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for Threeoak 91. Threeoak Lv 1 1 pt. 8,020
  2. Avatar for heyubob 92. heyubob Lv 1 1 pt. 7,884
  3. Avatar for nikokiki 93. nikokiki Lv 1 1 pt. 7,872
  4. Avatar for DoctorSockrates 94. DoctorSockrates Lv 1 1 pt. 7,735
  5. Avatar for Shova 95. Shova Lv 1 1 pt. 7,721
  6. Avatar for YorkG 96. YorkG Lv 1 1 pt. 7,675
  7. Avatar for Wipf 97. Wipf Lv 1 1 pt. 7,671
  8. Avatar for aftatar 98. aftatar Lv 1 1 pt. 7,637
  9. Avatar for MsHsi 99. MsHsi Lv 1 1 pt. 7,634
  10. Avatar for Old Chap 100. Old Chap Lv 1 1 pt. 7,565

Comments