Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for acarlson5 101. acarlson5 Lv 1 1 pt. 7,460
  2. Avatar for NewZealand 102. NewZealand Lv 1 1 pt. 6,469
  3. Avatar for 01010011111 103. 01010011111 Lv 1 1 pt. 5,438
  4. Avatar for bkoep 104. bkoep Lv 1 1 pt. 4,094
  5. Avatar for CharlieFortsConscience 105. CharlieFortsConscience Lv 1 1 pt. 4,094
  6. Avatar for Bithalbierer 106. Bithalbierer Lv 1 1 pt. 4,094
  7. Avatar for toshiue 107. toshiue Lv 1 1 pt. 4,094
  8. Avatar for drumpeter18yrs9yrs 108. drumpeter18yrs9yrs Lv 1 1 pt. 4,094
  9. Avatar for Museka 109. Museka Lv 1 1 pt. 4,094
  10. Avatar for Sciren 110. Sciren Lv 1 1 pt. 4,094

Comments