Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for Blipperman 21. Blipperman Lv 1 37 pts. 10,748
  2. Avatar for Deleted player 22. Deleted player pts. 10,726
  3. Avatar for silent gene 23. silent gene Lv 1 33 pts. 10,720
  4. Avatar for aznarog 24. aznarog Lv 1 31 pts. 10,692
  5. Avatar for frood66 25. frood66 Lv 1 30 pts. 10,688
  6. Avatar for knotartist 26. knotartist Lv 1 28 pts. 10,684
  7. Avatar for O Seki To 27. O Seki To Lv 1 26 pts. 10,617
  8. Avatar for TastyMunchies 28. TastyMunchies Lv 1 25 pts. 10,585
  9. Avatar for RockOn 29. RockOn Lv 1 24 pts. 10,584
  10. Avatar for Norrjane 30. Norrjane Lv 1 22 pts. 10,574

Comments