Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for vakobo 41. vakobo Lv 1 11 pts. 10,241
  2. Avatar for joremen 42. joremen Lv 1 10 pts. 10,208
  3. Avatar for pvc78 43. pvc78 Lv 1 10 pts. 10,131
  4. Avatar for georg137 44. georg137 Lv 1 9 pts. 10,114
  5. Avatar for Enzyme 45. Enzyme Lv 1 8 pts. 10,075
  6. Avatar for Idiotboy 46. Idiotboy Lv 1 8 pts. 10,053
  7. Avatar for versat82 47. versat82 Lv 1 7 pts. 10,051
  8. Avatar for fpc 48. fpc Lv 1 7 pts. 10,007
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 6 pts. 9,953
  10. Avatar for phi16 50. phi16 Lv 1 6 pts. 9,950

Comments