Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469

  1. Avatar for 181818 61. 181818 Lv 1 2 pts. 9,244
  2. Avatar for kevin everington 62. kevin everington Lv 1 2 pts. 9,180
  3. Avatar for ManVsYard 63. ManVsYard Lv 1 2 pts. 9,104
  4. Avatar for Sagadogo 64. Sagadogo Lv 1 2 pts. 9,090
  5. Avatar for rinze 65. rinze Lv 1 2 pts. 9,088
  6. Avatar for harvardman 66. harvardman Lv 1 2 pts. 9,075
  7. Avatar for Merf 67. Merf Lv 1 2 pts. 9,066
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 1 pt. 8,897
  9. Avatar for Savas 69. Savas Lv 1 1 pt. 8,865
  10. Avatar for kmfkim 70. kmfkim Lv 1 1 pt. 8,825

Comments