Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for alyssa_d_V2.0 71. alyssa_d_V2.0 Lv 1 1 pt. 8,814
  2. Avatar for rabamino12358 72. rabamino12358 Lv 1 1 pt. 8,737
  3. Avatar for felixxy 73. felixxy Lv 1 1 pt. 8,734
  4. Avatar for Arne Heessels 74. Arne Heessels Lv 1 1 pt. 8,719
  5. Avatar for boondog 75. boondog Lv 1 1 pt. 8,702
  6. Avatar for popandbob 76. popandbob Lv 1 1 pt. 8,675
  7. Avatar for hexidecimalhack 77. hexidecimalhack Lv 1 1 pt. 8,668
  8. Avatar for detectorist 78. detectorist Lv 1 1 pt. 8,575
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 1 pt. 8,548
  10. Avatar for tamanrasset 80. tamanrasset Lv 1 1 pt. 8,531

Comments