Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469

  1. Avatar for kathy65 81. kathy65 Lv 1 1 pt. 8,500
  2. Avatar for hada 82. hada Lv 1 1 pt. 8,411
  3. Avatar for vuvuvu 83. vuvuvu Lv 1 1 pt. 8,349
  4. Avatar for JasperD 84. JasperD Lv 1 1 pt. 8,346
  5. Avatar for Daniele_Alfano 85. Daniele_Alfano Lv 1 1 pt. 8,338
  6. Avatar for Dhalion 86. Dhalion Lv 1 1 pt. 8,328
  7. Avatar for Alistair69 87. Alistair69 Lv 1 1 pt. 8,247
  8. Avatar for Joed 88. Joed Lv 1 1 pt. 8,195
  9. Avatar for rezaefar 89. rezaefar Lv 1 1 pt. 8,067
  10. Avatar for donuts554 90. donuts554 Lv 1 1 pt. 8,043

Comments