Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,104
  2. Avatar for Go Science 2. Go Science 74 pts. 11,079
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,975
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,953
  5. Avatar for Contenders 5. Contenders 27 pts. 10,950
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,944
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,836
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,748
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,617
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 10,314
  1. Avatar for robgee 11. robgee Lv 1 63 pts. 10,919
  2. Avatar for diamonddays 12. diamonddays Lv 1 60 pts. 10,896
  3. Avatar for pauldunn 13. pauldunn Lv 1 57 pts. 10,895
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 54 pts. 10,886
  5. Avatar for Galaxie 15. Galaxie Lv 1 51 pts. 10,884
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 49 pts. 10,882
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 46 pts. 10,864
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 44 pts. 10,820
  9. Avatar for Phyx 19. Phyx Lv 1 41 pts. 10,819
  10. Avatar for nicobul 20. nicobul Lv 1 39 pts. 10,805

Comments