Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,104
  2. Avatar for Go Science 2. Go Science 74 pts. 11,079
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,975
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,953
  5. Avatar for Contenders 5. Contenders 27 pts. 10,950
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,944
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,836
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,748
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,617
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 10,314
  1. Avatar for MicElephant 31. MicElephant Lv 1 21 pts. 10,520
  2. Avatar for Vinara 32. Vinara Lv 1 20 pts. 10,516
  3. Avatar for guineapig 33. guineapig Lv 1 18 pts. 10,473
  4. Avatar for manu8170 34. manu8170 Lv 1 17 pts. 10,419
  5. Avatar for alwen 35. alwen Lv 1 16 pts. 10,334
  6. Avatar for heather-1 36. heather-1 Lv 1 15 pts. 10,327
  7. Avatar for haabermaaster 37. haabermaaster Lv 1 14 pts. 10,314
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 13 pts. 10,278
  9. Avatar for Silvercraft 39. Silvercraft Lv 1 13 pts. 10,272
  10. Avatar for stomjoh 40. stomjoh Lv 1 12 pts. 10,262

Comments