Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for Pawel Tluscik 41. Pawel Tluscik Lv 1 13 pts. 8,791
  2. Avatar for Vinara 42. Vinara Lv 1 13 pts. 8,784
  3. Avatar for aznarog 43. aznarog Lv 1 12 pts. 8,783
  4. Avatar for alwen 44. alwen Lv 1 11 pts. 8,769
  5. Avatar for Merf 45. Merf Lv 1 10 pts. 8,769
  6. Avatar for hansvandenhof 46. hansvandenhof Lv 1 10 pts. 8,767
  7. Avatar for kevin everington 47. kevin everington Lv 1 9 pts. 8,725
  8. Avatar for stomjoh 48. stomjoh Lv 1 9 pts. 8,720
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 8 pts. 8,694
  10. Avatar for rezaefar 50. rezaefar Lv 1 8 pts. 8,690

Comments