Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,096
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,045
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,034
  4. Avatar for HMT heritage 4. HMT heritage 38 pts. 9,021
  5. Avatar for Contenders 5. Contenders 27 pts. 9,002
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,000
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 8,977
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,945
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 8,873
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 8,858
  1. Avatar for Pawel Tluscik 41. Pawel Tluscik Lv 1 13 pts. 8,791
  2. Avatar for Vinara 42. Vinara Lv 1 13 pts. 8,784
  3. Avatar for aznarog 43. aznarog Lv 1 12 pts. 8,783
  4. Avatar for alwen 44. alwen Lv 1 11 pts. 8,769
  5. Avatar for Merf 45. Merf Lv 1 10 pts. 8,769
  6. Avatar for hansvandenhof 46. hansvandenhof Lv 1 10 pts. 8,767
  7. Avatar for kevin everington 47. kevin everington Lv 1 9 pts. 8,725
  8. Avatar for stomjoh 48. stomjoh Lv 1 9 pts. 8,720
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 8 pts. 8,694
  10. Avatar for rezaefar 50. rezaefar Lv 1 8 pts. 8,690

Comments