Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for Squirrely 81. Squirrely Lv 1 1 pt. 8,320
  2. Avatar for popandbob 82. popandbob Lv 1 1 pt. 8,319
  3. Avatar for alcor29 83. alcor29 Lv 1 1 pt. 8,299
  4. Avatar for cinnamonkitty 84. cinnamonkitty Lv 1 1 pt. 8,282
  5. Avatar for Sinoson 85. Sinoson Lv 1 1 pt. 8,282
  6. Avatar for Crossed Sticks 86. Crossed Sticks Lv 1 1 pt. 8,279
  7. Avatar for xbp 87. xbp Lv 1 1 pt. 8,242
  8. Avatar for Pikamander2 88. Pikamander2 Lv 1 1 pt. 8,234
  9. Avatar for Auntecedent 89. Auntecedent Lv 1 1 pt. 8,234
  10. Avatar for alyssa_d_V2.0 90. alyssa_d_V2.0 Lv 1 1 pt. 8,125

Comments