Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Go Science 100 pts. 9,096
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,045
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,034
  4. Avatar for HMT heritage 4. HMT heritage 38 pts. 9,021
  5. Avatar for Contenders 5. Contenders 27 pts. 9,002
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,000
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 8,977
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,945
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 8,873
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 8,858

  1. Avatar for Squirrely 81. Squirrely Lv 1 1 pt. 8,320
  2. Avatar for popandbob 82. popandbob Lv 1 1 pt. 8,319
  3. Avatar for alcor29 83. alcor29 Lv 1 1 pt. 8,299
  4. Avatar for cinnamonkitty 84. cinnamonkitty Lv 1 1 pt. 8,282
  5. Avatar for Sinoson 85. Sinoson Lv 1 1 pt. 8,282
  6. Avatar for Crossed Sticks 86. Crossed Sticks Lv 1 1 pt. 8,279
  7. Avatar for xbp 87. xbp Lv 1 1 pt. 8,242
  8. Avatar for Pikamander2 88. Pikamander2 Lv 1 1 pt. 8,234
  9. Avatar for Auntecedent 89. Auntecedent Lv 1 1 pt. 8,234
  10. Avatar for alyssa_d_V2.0 90. alyssa_d_V2.0 Lv 1 1 pt. 8,125

Comments