Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,676
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 10,493
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,306
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,251
  5. Avatar for 2022_MUfolders 15. 2022_MUfolders 1 pt. 9,784
  6. Avatar for Team China 16. Team China 1 pt. 9,713
  7. Avatar for Russian team 17. Russian team 1 pt. 9,639
  8. Avatar for :) 18. :) 1 pt. 9,559
  1. Avatar for Glen B 41. Glen B Lv 1 17 pts. 11,021
  2. Avatar for jausmh 42. jausmh Lv 1 17 pts. 11,003
  3. Avatar for Norrjane 43. Norrjane Lv 1 16 pts. 11,002
  4. Avatar for alcor29 44. alcor29 Lv 1 15 pts. 10,991
  5. Avatar for Silvercraft 45. Silvercraft Lv 1 14 pts. 10,969
  6. Avatar for Idiotboy 46. Idiotboy Lv 1 13 pts. 10,968
  7. Avatar for gdnskye 47. gdnskye Lv 1 13 pts. 10,962
  8. Avatar for vuvuvu 48. vuvuvu Lv 1 12 pts. 10,958
  9. Avatar for stomjoh 49. stomjoh Lv 1 11 pts. 10,939
  10. Avatar for Museka 50. Museka Lv 1 11 pts. 10,903

Comments