Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for HMT heritage 100 pts. 11,332
  2. Avatar for Go Science 2. Go Science 74 pts. 11,289
  3. Avatar for Contenders 3. Contenders 54 pts. 11,288
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,285
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,254
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,210
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 11,191
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,168
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 11,103
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,958

  1. Avatar for O Seki To
    1. O Seki To Lv 1
    100 pts. 11,332
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 97 pts. 11,289
  3. Avatar for Galaxie 3. Galaxie Lv 1 93 pts. 11,279
  4. Avatar for grogar7 4. grogar7 Lv 1 90 pts. 11,275
  5. Avatar for Deleted player 5. Deleted player pts. 11,275
  6. Avatar for georg137 6. georg137 Lv 1 83 pts. 11,265
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 80 pts. 11,264
  8. Avatar for LociOiling 8. LociOiling Lv 1 77 pts. 11,254
  9. Avatar for mirp 9. mirp Lv 1 74 pts. 11,248
  10. Avatar for Deleted player 10. Deleted player 71 pts. 11,239

Comments