Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,676
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 10,493
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,306
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,251
  5. Avatar for 2022_MUfolders 15. 2022_MUfolders 1 pt. 9,784
  6. Avatar for Team China 16. Team China 1 pt. 9,713
  7. Avatar for Russian team 17. Russian team 1 pt. 9,639
  8. Avatar for :) 18. :) 1 pt. 9,559
  1. Avatar for cobaltteal 61. cobaltteal Lv 1 6 pts. 10,709
  2. Avatar for cbwest 62. cbwest Lv 1 5 pts. 10,707
  3. Avatar for Amitron 63. Amitron Lv 1 5 pts. 10,706
  4. Avatar for Artoria2e5 64. Artoria2e5 Lv 1 5 pts. 10,701
  5. Avatar for pandapharmd 65. pandapharmd Lv 1 4 pts. 10,697
  6. Avatar for JasperD 66. JasperD Lv 1 4 pts. 10,676
  7. Avatar for CAN1958 67. CAN1958 Lv 1 4 pts. 10,637
  8. Avatar for haabermaaster 68. haabermaaster Lv 1 4 pts. 10,637
  9. Avatar for knotartist 69. knotartist Lv 1 3 pts. 10,635
  10. Avatar for Merf 70. Merf Lv 1 3 pts. 10,618

Comments