Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,676
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 10,493
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,306
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,251
  5. Avatar for 2022_MUfolders 15. 2022_MUfolders 1 pt. 9,784
  6. Avatar for Team China 16. Team China 1 pt. 9,713
  7. Avatar for Russian team 17. Russian team 1 pt. 9,639
  8. Avatar for :) 18. :) 1 pt. 9,559
  1. Avatar for SiliconDioxide 71. SiliconDioxide Lv 1 3 pts. 10,607
  2. Avatar for rabamino12358 72. rabamino12358 Lv 1 3 pts. 10,599
  3. Avatar for heather-1 73. heather-1 Lv 1 3 pts. 10,564
  4. Avatar for hansvandenhof 74. hansvandenhof Lv 1 2 pts. 10,564
  5. Avatar for ManVsYard 75. ManVsYard Lv 1 2 pts. 10,561
  6. Avatar for hada 76. hada Lv 1 2 pts. 10,527
  7. Avatar for fpc 77. fpc Lv 1 2 pts. 10,517
  8. Avatar for ProteinProgrammingLanguage 78. ProteinProgrammingLanguage Lv 1 2 pts. 10,516
  9. Avatar for multaq 79. multaq Lv 1 2 pts. 10,495
  10. Avatar for NewZealand 80. NewZealand Lv 1 2 pts. 10,493

Comments