Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,676
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 10,493
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,306
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,251
  5. Avatar for 2022_MUfolders 15. 2022_MUfolders 1 pt. 9,784
  6. Avatar for Team China 16. Team China 1 pt. 9,713
  7. Avatar for Russian team 17. Russian team 1 pt. 9,639
  8. Avatar for :) 18. :) 1 pt. 9,559

  1. Avatar for boondog 81. boondog Lv 1 2 pts. 10,417
  2. Avatar for jamiexq 82. jamiexq Lv 1 1 pt. 10,388
  3. Avatar for wosser1 83. wosser1 Lv 1 1 pt. 10,359
  4. Avatar for edpalas 84. edpalas Lv 1 1 pt. 10,356
  5. Avatar for Altercomp 85. Altercomp Lv 1 1 pt. 10,333
  6. Avatar for abiogenesis 86. abiogenesis Lv 1 1 pt. 10,326
  7. Avatar for alyssa_d_V2.0 87. alyssa_d_V2.0 Lv 1 1 pt. 10,306
  8. Avatar for Squirrely 88. Squirrely Lv 1 1 pt. 10,303
  9. Avatar for kitek314_pl 89. kitek314_pl Lv 1 1 pt. 10,251
  10. Avatar for kevin everington 90. kevin everington Lv 1 1 pt. 10,239

Comments