Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for HMT heritage 100 pts. 11,332
  2. Avatar for Go Science 2. Go Science 74 pts. 11,289
  3. Avatar for Contenders 3. Contenders 54 pts. 11,288
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,285
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,254
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,210
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 11,191
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,168
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 11,103
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,958

  1. Avatar for roman madala 101. roman madala Lv 1 1 pt. 10,007
  2. Avatar for drumpeter18yrs9yrs 102. drumpeter18yrs9yrs Lv 1 1 pt. 10,004
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 1 pt. 9,964
  4. Avatar for detectorist 104. detectorist Lv 1 1 pt. 9,945
  5. Avatar for wozzarelli 105. wozzarelli Lv 1 1 pt. 9,925
  6. Avatar for Kevonni 106. Kevonni Lv 1 1 pt. 9,916
  7. Avatar for javierlopez 107. javierlopez Lv 1 1 pt. 9,858
  8. Avatar for marcdmc 108. marcdmc Lv 1 1 pt. 9,816
  9. Avatar for Benjamin2020 109. Benjamin2020 Lv 1 1 pt. 9,790
  10. Avatar for MrZanav 110. MrZanav Lv 1 1 pt. 9,787

Comments