Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for HMT heritage 100 pts. 11,332
  2. Avatar for Go Science 2. Go Science 74 pts. 11,289
  3. Avatar for Contenders 3. Contenders 54 pts. 11,288
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,285
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,254
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,210
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 11,191
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,168
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 11,103
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,958

  1. Avatar for cobaltteal 61. cobaltteal Lv 1 6 pts. 10,709
  2. Avatar for cbwest 62. cbwest Lv 1 5 pts. 10,707
  3. Avatar for Amitron 63. Amitron Lv 1 5 pts. 10,706
  4. Avatar for Artoria2e5 64. Artoria2e5 Lv 1 5 pts. 10,701
  5. Avatar for pandapharmd 65. pandapharmd Lv 1 4 pts. 10,697
  6. Avatar for JasperD 66. JasperD Lv 1 4 pts. 10,676
  7. Avatar for CAN1958 67. CAN1958 Lv 1 4 pts. 10,637
  8. Avatar for haabermaaster 68. haabermaaster Lv 1 4 pts. 10,637
  9. Avatar for knotartist 69. knotartist Lv 1 3 pts. 10,635
  10. Avatar for Merf 70. Merf Lv 1 3 pts. 10,618

Comments