Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for HMT heritage 100 pts. 11,332
  2. Avatar for Go Science 2. Go Science 74 pts. 11,289
  3. Avatar for Contenders 3. Contenders 54 pts. 11,288
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,285
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,254
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,210
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 11,191
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,168
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 11,103
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,958

  1. Avatar for ibodi 131. ibodi Lv 1 1 pt. 4,729
  2. Avatar for jasbjorn 132. jasbjorn Lv 1 1 pt. 0
  3. Avatar for Keresto 133. Keresto Lv 1 1 pt. 0
  4. Avatar for muffnerk 134. muffnerk Lv 1 1 pt. 0

Comments