Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Deleted group 17. Deleted group pts. 0

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 9,819
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 77 pts. 9,817
  3. Avatar for toshiue 3. toshiue Lv 1 58 pts. 9,816
  4. Avatar for silent gene 4. silent gene Lv 1 43 pts. 9,810
  5. Avatar for mirp 5. mirp Lv 1 31 pts. 9,806
  6. Avatar for Amphimixus 7. Amphimixus Lv 1 15 pts. 9,781
  7. Avatar for LociOiling 8. LociOiling Lv 1 11 pts. 9,760
  8. Avatar for Galaxie 9. Galaxie Lv 1 7 pts. 9,757
  9. Avatar for retiredmichael 10. retiredmichael Lv 1 5 pts. 9,752

Comments