Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Void Crushers 100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262

  1. Avatar for Timo van der Laan 100 pts. 9,842
  2. Avatar for Phyx 2. Phyx Lv 1 97 pts. 9,808
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 9,782
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 91 pts. 9,780
  5. Avatar for Threeoak 5. Threeoak Lv 1 88 pts. 9,775
  6. Avatar for LociOiling 6. LociOiling Lv 1 85 pts. 9,765
  7. Avatar for tyler0911 7. tyler0911 Lv 1 82 pts. 9,762
  8. Avatar for Galaxie 8. Galaxie Lv 1 79 pts. 9,757
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 76 pts. 9,747
  10. Avatar for robgee 10. robgee Lv 1 74 pts. 9,736

Comments