Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Deleted group 17. Deleted group pts. 0

  1. Avatar for rinze 101. rinze Lv 1 1 pt. 8,412
  2. Avatar for roman madala 102. roman madala Lv 1 1 pt. 8,412
  3. Avatar for Deleted player 103. Deleted player 1 pt. 8,390
  4. Avatar for Axolotlprime 104. Axolotlprime Lv 1 1 pt. 8,383
  5. Avatar for Savas 105. Savas Lv 1 1 pt. 8,381
  6. Avatar for frostschutz 106. frostschutz Lv 1 1 pt. 8,370
  7. Avatar for xbp 107. xbp Lv 1 1 pt. 8,359
  8. Avatar for Lexonix 108. Lexonix Lv 1 1 pt. 8,265
  9. Avatar for genueman 109. genueman Lv 1 1 pt. 8,236
  10. Avatar for xythus 110. xythus Lv 1 1 pt. 8,217

Comments